DISJA_BOTJA RTDTVSTPVSGNELLEAGEECDCGTPGNPCCDAATCKLRPGAQCAEGLCCDQCRFMKEGTVCRRARGDDMDDYCNGISAGCPRNPFHA Binds alpha-5/beta-1 (ITGAV/ITGB1), alpha-v/beta-3 (ITGAV/ITGB3) and alpha-M/beta-2 (ITGAM/ITGB2) integrins. Is a potent inhibitor of platelet aggregation induced by ADP, collagen, and thrombin. Induces neutrophil chemotaxis and inhibits the chemotaxis of human neutrophils toward fMLP, IL-8, and jarastatin itself. Directly activates an integrin-coupled signaling and modulate the MAPK pathway in different ways, leading the neutrophils to express different functional response. Jarastatin- treated neutrophils accumulates F-actin at the plasmalemma. Induces focal adhesion kinase (FAK) and phosphoinositide 3-kinase (PI3K) activation. Induces Erk-2 translocation to nucleus and a delay of the spontaneous apoptosis of neutrophils. Increases the IL-8 mRNA levels in neutrophils. When injected simultaneously with melanoma cells in mice, jarastatin, flavoridin (FL) and kistrin (KR), significantly reduce tumor lung colonization. Jarastatin inhibits B16F10 cell growth in vitro. When it interacts with melanoma cells, it induces actin cytoskeleton rearrangement, increasing actin polymerization and FAK phosphorylation. Interferes with NF-kappaB translocation in melanoma cells. Disintegrin jarastatin-EC (Fragment) Disintegrin jarastatin Platelet aggregation activation inhibitor Disintegrin jarastatin-GEEC 88 Jarastatin Disintegrin jarastatin-AGEEC