CG5134 144 Mediator of RNA polymerase II transcription subunit 9 MMDLSPNNQIEDRKPILTADGLVQTSNSPFEPTISQETQTSNGIGGQCHLTVDQLDIEILPIIYDIVRCVEKDPLENAVKLRESQDCNHKIFELQKRFESAREQIRQLPGIDFNKEEQQQRLELLRNQLKLKQQLIRKYKDTEF MED9 Mediator complex subunit 9 Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity). MED9_DROME