Molybdenum cofactor synthesis protein 2 small subunit CG10238 Molybdopterin synthase sulfur carrier subunit Mocs2 Sulfur carrier protein MOCS2A Molybdenum cofactor synthesis protein 2A MNADGPVVNVHVLFFAKSRELANTPRSTVEVPTEITATELLDHLVSKFGLTSIRDNLILAHNESYIDNLSDRILFKEGDELAIIPPLSGG 90 Acts as a sulfur carrier required for molybdopterin biosynthesis. Component of the molybdopterin synthase complex that catalyzes the conversion of precursor Z into molybdopterin by mediating the incorporation of 2 sulfur atoms into precursor Z to generate a dithiolene group. In the complex, serves as sulfur donor by being thiocarboxylated (-COSH) at its C-terminus by MOCS3. After interaction with MOCS2B, the sulfur is then transferred to precursor Z to form molybdopterin (By similarity). MOC2A_DROME