mrpF2 Putative antiporter subunit mnhF2 MNHF2_STAAU Mrp complex subunit F2 mnhF2 MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMGTVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL Putative NADH-ubiquinone oxidoreductase subunit mnhF2 100 Expression of the mnh2 operon in E.coli is not able to catalyze Na(+)Li(+)/H(+) antiport. It does however confer higher growth rates than the control strain at up to pH 9.5. The operon may encode an NADH-ubiquinone oxidoreductase.