atpH F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation (By similarity). ATPD_AQUAE F-type ATPase subunit delta 181 This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction (By similarity). aq_1588 ATP synthase F(1) sector subunit delta MLKRKELARKAVRLIVKKVPKEKESILKVDEFLGTLSTAYRKDKLLRNFFLSPQIDRNAKVKALESLAKKYDVPKEVLEVLEYLIDINAMALIPEIKRLYELELEKLMGMLKGELILAKKPSKKLLEKITKTINDILNRQIEIEVKEDPSLIGGFVFKTQAFVLDTSVKTQLEKLARVGGV ATP synthase subunit delta