rplA CJE0525 233 50S ribosomal protein L1 RL1_CAMJR MAKIAKRLKELSQKIDSNKEYALSDAIDTIKTLKSAKFDETVEIALKLNVDPRHADQMVRGSVVLPAGTGKKVRVAVIAKDAKADEAKNAGADIVGSDDLVEEIQKGNMNFDVLIATPNLMGLVGKVGRILGPKGLMPNPKTGTVTMDVAQAVNNAKSGQVNFRVDKQGNIHAGLGKVSFSKEQLWDNVSTFVKAINKHKPAAAKGRYIKNAALSLTMSPSVKLETQELLDMK Protein L1 is also a translational repressor protein, it controls the translation of the L11 operon by binding to its mRNA (By similarity). Binds directly to 23S rRNA. The L1 stalk is quite mobile in the ribosome, and is involved in E site tRNA release (By similarity).