rpsN Binds 16S rRNA, required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site (By similarity). BL1593 30S ribosomal protein S14 type Z RS14Z_BIFLO rpsZ MAKTALKNKAAGKPKFKVRAYTRCQVCGRPHSVYRKFGLCRICLREKAHRGELPGVTKSSW 61