30S ribosomal protein S18 71 Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit (By similarity). RS18_THEEB rps18 MAFYRRRISPIPPGQPIDYKDVDLLRRFITERGKILPRRVTGLTAKQQRQLAVAIKRARIMALLPFLNLEG tsr2061 rpsR