rpsD RS4_BIFLD 30S ribosomal protein S4 One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the body of the 30S subunit (By similarity). 208 MTNVQRSRRQVRLSRALGIALTPKAQRIFEKRPYAPGEHGRDRRRTESDYAVRMREKQRLRAQYGISEKQLRAAYEKATRTAGQTGNAMLTDLETRLDNLVLRAGFARTTAQARQFVVHRHILVDGNIVDRPSYRVKPGQTIQVKAKSQTMVPFQIAAEGVHRDVLPAVPGYLDVNLPSLKATVTRKPEVEEIPVQVNIQYVVEFYAR With S5 and S12 plays an important role in translational accuracy (By similarity). BLD_0623