lpg0325 30S ribosomal protein S7 MPRRREVPKREILPDPKHHSELLAKFINVLMVSGKKSIAEKITYGALSVMEERVKKIKKNEEDGSETGSSGSAGAVLRYFEEALDNVRPSVEVRSRRVGGATYQVPVEVRHDRSIALGMRWIVQAARTRGEKGMMLRLAGELMDAYENKGSAVKKREDTHKMAKANQAFAHFRWN RS7_LEGPH One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the head domain of the 30S subunit. Is located at the subunit interface close to the decoding center, probably blocks exit of the E-site tRNA (By similarity). 175 rpsG