ruvA The RuvA-RuvB complex in the presence of ATP renatures cruciform structure in supercoiled DNA with palindromic sequence, indicating that it may promote strand exchange reactions in homologous recombination. RuvAB is an helicase that mediates the Holliday junction migration by localized denaturation and reannealing. RuvA stimulates, in the presence of DNA, the weak ATPase activity of RuvB (By similarity). RUVA_BIFLS 208 Holliday junction ATP-dependent DNA helicase RuvA Blon_1157 MIGMLTGRVESVETDTALIDVGGVGYETRMPATDLGRLHAGQDACVFTYLNLSQDSVTLYGFLDRDSKRVFLQLIKVSGIGPKVAQSLLGTMTPSQLARAIADNDAAALAKAPGLGRKGAQKIILELKGSVDLNQSDDASAGNAPYQPTVDAGVEQVVEGLVSLGWRQQDAQRAVNEACAENDVPMPLASDDAPRVLRLALARMDRGR BLIJ_1184