SEPF_BIFLD Cell division protein sepF MAGFMKNAMSYLGMSDVVDDEDDYIEEDEEQKPASKSAFDSDHTVTPLASTTAPAASSTTKPFPGGRVNRITTIHPKSYEDAQLVGRALRDGVPVVLNLTGVAEAVAYRIVDFSAGVVFGVRGSLERVTPRVFLLSPAQVNIKVEEPTKPASAHDLFAD Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cross-linking of ftsZ protofilaments. Its function overlaps with ftsA (By similarity). sepF 159 BLD_0137