MFDIGFSELLLVLVIGLVVLGPERLPVAVRTVSGWIRTLRSLAATVQNELAQELKLQELQDSLKKVEQAGLQNLTPELKASMDELKEAAEALKRSYHVDAGSEAPHTIHNPLVTEPEAIHDGVTPAEPATQVSALAQAPNILEAGTASVADSVVEAAPVTTVKSVVQGEVLVKSTPVQEVGLADVMDKPVTKQQIDTIDSHGTDLSSAGPSRIHQPGGDQ tatB Sec-independent protein translocase protein TatB YPTB0259 Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. Together with TatC, TatB is part of a receptor directly interacting with Tat signal peptides. TatB may form an oligomeric binding site that transiently accomodates folded Tat precursor proteins before their translocation (By similarity). 220 TATB_YERPS