Transcriptional regulatory protein AlgQ MLESCRNAQERWGGVHQLIDRWLHERQQLVQAFDALSGIQAPAPNAEELQHFCQLLLDYVSAGHFEVYEQLTAEGKAFGDQRGLELAKQIFPRLEAITESALNFNDRCDNGDCREGACLIAELKVLRQQLHERFELEDCLIEVLHNAHSQSGAEGSAVPV algQ ALGQ_PSEAE algR2 PA5255 Alginate regulatory protein AlgR2 The promoter for a critical alginate biosynthetic gene, AlgD, encoding GDP-mannose dehydrogenase, is activated only under conditions reminiscent of the cystic fibrosis lung (i.e., under high osmolarity), and at least two regulatory genes, AlgP and AlgQ, have been implicated in this activation process. 160