Divisome component that associates with the complex late in its assembly, after the Z-ring is formed, and is dependent on DivIC and PBP2B for its recruitment to the divisome. Together with EzrA, is a key component of the system that regulates PBP1 localization during cell cycle progression. Its main role could be the removal of PBP1 from the cell pole after pole maturation is completed. Also contributes to the recruitment of PBP1 to the division complex. Not essential for septum formation (By similarity). Cell cycle protein GpsB gpsB GPSB_STAA9 MSDVSLKLSAKDIYEKDFEKTMARGYRREEVDAFLDDIIADYQKMADMNNEVVKLSEENHKLKKELEELRLRVATSRPQDNKSFSSNNTTTNTSSNNVDILKRISNLEKAVFGK SaurJH9_1505 Guiding PBP1-shuttling protein 114