Imidazole glycerol phosphate synthase subunit HisH ImGP synthase subunit HisH HIS5_ANAVT Ava_4017 IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit provides the glutamine amidotransferase activity that produces the ammonia necessary to HisF for the synthesis of IGP and AICAR (By similarity). 211 MPVVAVIDYEMGNLHSVCKGLEKAGATPIITHSHQELTKADAVILPGVGAFDPAVQSLRSRDLEQPIKDTIASGKPFLGICLGLQILFESSAEGTQPGLGIIKGKVRRFISEPGITIPHMGWNQLELTQPKSILWEHLPPQPWVYFVHSYYVDPVEPQVRAATVTHGTQTVTAAIAHENLMAVQFHPEKSSNIGLQILSNFVSQVREKIAA IGP synthase subunit HisH IGP synthase glutamine amidotransferase subunit hisH