MAADKQQQQAPVAFNPADPPNIKAANFKDMLPVDVITILNQNIDELDYTKYTEDEISEGLKQLFMGTARTMVSLRQRHLKSLVRRSDMFAQNDASTWARPNIGLKRTFPPRFMQPISED 119 Capsid protein VP26 VP26_EHV1V Participates in the assembly of the infectious particles by decorating the outer surface of the capsid shell and thus forming a layer between the capsid and the tegument. Complexes composed of the capsid protein VP5 and VP26 assemble together in the host cytoplasm and are translocated to the nucleus, where they accumulate and participate in capsid assembly (By similarity). 25 25