Protein Vpx Viral protein X Plays a role in nuclear translocation of the viral pre- integration complex (PIC), thus is required for the virus to infect non-dividing cells. May be necessary for virus replication (By similarity). X ORF protein MTDPRERVPPGNSGEETIGEAFEWLDRTIEALNREAVNHLPRELIFQVWQRSWRYWHDDQGMSPSYTKYRYLCLMQKAVFIHFKRGCTCLGGGHGPGGWRSGPPPPPPPGLV 112 VPX_HV2G1 vpx