Matrix protein p17 targets Gag and Gag-pol polyproteins to the plasma membrane via a multipartite membrane binding signal. Also mediates nuclear localization of the preintegration complex (By similarity). Capsid protein p24 gag Gag polyprotein 519 Matrix protein p17 p6-gag Spacer peptide p2 Pr55Gag Nucleocapsid protein p7 MGARGSVLSGKKTDELEKVRLRPGGKKRYMLKHIVWAVNELERFGLAESRLGSKEGCRKIRKVLGPLVPTGSENLKSLYNTVCVIFCLHAEEKVKDTEEAKKIAQRHLAADTEKMPAMSKPSKPTSRLAYPVQQIAGNYSHLPLSPRTLNAWVKLVEEKKFGAEVVPGFQALSEGCTPYDINQMLNCVGEHQAAMQIIREIINEEAADWDQQHPSPGPMPAGQLREPRGSDIAGTTSTVEEQIQWMYRPQNPVPVGNIYRRWIQLGLQKCVRMYNPTNILDIKQGPKEPFQSYVDRFYKSLRAEQTDPAVKNWMTQTLLIQNANPDCKLVLKGLGMNPTLEEMLTACQGIGGPGQKARLMAEALKEALTPSTNPFAAAQPRAGKRTVTCWNCGKAGHTARQCKAPRRQGCWKCGQQGHIMSKCPERQAGFLGFGPWGKKPRNFPVQAPQGIVPSAPPMNPAFGMTPQGAIPSAPPADPAEEMLKNYMQLGKKQKENRERPYKEVTEDLLHLNSLFGEDQ Capsid protein p24 forms the conical core of the virus that encapsulates the genomic RNA-nucleocapsid complex (By similarity). Nucleocapsid protein p7 encapsulates and protects viral dimeric unspliced (genomic) RNA. Binds these RNAs through its zinc fingers (By similarity). GAG_HV2EH p6-gag plays a role in budding of the assembled particle by interacting with the host class E VPS proteins TSG101 and PDCD6IP/AIP1 (By similarity). Spacer peptide p1