146 MDERFIAYIPTAGSNVAHAEITSPTLVKMMIRRAKKPILILGENLEENEKELISKLIEKFNLKTIKTPEEMNLMAIMKYLASSDYDLALFTGITYYYLAQAATHLKQFSNVVTISIDKYYQPNTLYSFPNLSKEEYLDYLRKLLEG cdhB MJ0154 Acetyl-CoA decarbonylase/synthase complex subunit epsilon ACDE_METJA Part of a complex that catalyzes the reversible cleavage of acetyl-CoA, allowing autotrophic growth from CO(2). Probably has a structural role in stabilizing the alpha-epsilon subcomponent of the ACDS complex by forming a structural link between the two alpha subunits (By similarity).