50S ribosomal protein L22P rpl22p This protein binds specifically to 23S rRNA. It makes multiple contacts with different domains of the 23S rRNA in the assembled 50S subunit and ribosome (By similarity). MAKRFGYSFQNFDPKRMARASARDLRISPKLAVEVCRELRGMMLNDALRYLDDVIALKRPVPLKRYNDSQGHKPGKGFGPGRYPVKVAKAIKKVLLNVKNNAVQKGLDPDKLKIIHIAAHKGPVLRGWYPRAFGRATPFNEQTTHIEVVVEEIRR The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome (By similarity). 155 PF1820 RL22_PYRFU