186 50S ribosomal protein L5P MAVEIPNKEQILADWEAHPMRRPRIEKVTINIGVGESGERLTKAEIMLQQLTGQKPIRRKAKKTNRDFGIRRGEPIAVKVTLRGPKAYELLKRLLAAVDNRLKASSFDEHGNVCFGIEEHINIPGVEYDPEIGIFGMDVCVTLERPGFRVARRKRKRAKIPTRHKLTKEEGMVYMMEEFGVEIVEG rpl5p This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. May contact the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs (By similarity). PF1811 RL5_PYRFU