METSLRLRGGGSRPQSKSQEGLRIHAKEKLPIASNALLQAHGEIHAATGAPTYLALLFRNFYPRLSANLGLGLAIHFRNNQPLPLAWDNFSYTLRASKAIIPFPSNALLGINLKGRLLADKYFNPTTRTAAVELAWTILDLKRGQDVRLKLGYQLLHKMPYFQLRENNWTFNAYMDGKWDVRFDL Chloroplastic outer envelope pore protein of 21 kDa Outer envelope pore protein 21, chloroplastic OEP21 OsI_09575 185 Voltage-dependent rectifying anion channel that facilitates the translocation between chloroplast and cytoplasm of phosphorylated carbohydrates such as triosephosphate, 3- phosphoglycerate and inorganic phosphate (Pi) depending of ATP to triosephosphate ratio in the plastidial intermembrane space; in high triosephosphate/ATP conditions (e.g. photosynthesis), export of triosphophate from chloroplast (outward rectifying channels), but in high ATP/triosephosphate conditions (e.g. dark phase), import of phosphosolutes (inward rectifying channels) (By similarity). OEP21_ORYSI