ndhJ NAD(P)H dehydrogenase subunit J NAD(P)H-quinone oxidoreductase subunit J, chloroplastic MQQGWLSNWLVKHEVVHRSLGFDHRGIETLQIKAEDWDSIAVILYVYGYNYLRSQCAYDVAPGGSLASVYHLTRIQYGIDNPEEVCIKVFAQKDNPRIPSVFWIWRSSDFQERESFDMVGISYDNHPRLKRILMPESWIGWPLRKDYITPNFYEIQDAH NADH-plastoquinone oxidoreductase subunit J NDHJ_ORYSJ Nip057 NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity). 159