ndhC NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity). 120 NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic MFLLYEYDIFWAFLLISSAIPVLAFLISGVLSPIRKGPEKLSSYESGIEPIGDAWLQFRIRYYMFALVFVVFDVETVFLYPWAMSFDVLGVSAFIEAFIFVLILILGLVYAWRKGALEWS NAD(P)H dehydrogenase subunit 3 NADH-plastoquinone oxidoreductase subunit 3 AtCg00440 NU3C_ARATH