Mitochondrial import receptor subunit TOM20-4 TO204_ARATH Translocase of outer membrane 20 kDa subunit 4 187 At5g40930 TOM20-4 Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the translocation pore. MDMQNENERLMVFEHARKVAEATYVKNPLDAENLTRWAGALLELSQFQTEPKQMILEAILKLGEALVIDPKKHDALWLIGNAHLSFGFLSSDQTEASDNFEKASQFFQLAVEEQPESELYRKSLTLASKAPELHTGGTAGPSSNSAKTMKQKKTSEFKYDVFGWVILASYVVAWISFANSQTPVSRQ MMG1.2