122 OJ1339_B08.1 P0506C07.2 MAAEEGVVIACHNKDEFDAQMTKAKEAGKVVIIDFTASWCGPCRFIAPVFAEYAKKFPGAVFLKVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKHVGATAASASA LOC_Os07g08840 RPP13-1 TRXH1_ORYSJ Phloem sap 13 kDa protein 1 Os07g0186000 Thioredoxin H1 Thiol-disulfide oxidoreductase involved in the redox regulation of MAP kinases. Under reducing conditions, inhibits MPK1 and MPK5 kinase activities. Mediates its own transport from cell-to-cell through plasmodesmata. Possesses insulin disulfide bonds reducing activity. TRXH OsJ_022432