EN67 Protein TARGET OF MOOPTEROS 7 Transcription factor EN 67 93 BHLH135 BS1 BH135_ARATH F1M20.18 Protein PACLOBUTRAZOL RESISTANCE 1 MSGRRSRSRQSSGTSRISEDQINDLIIKLQQLLPELRDSRRSDKVSAARVLQDTCNYIRNLHREVDDLSERLSELLANSDTAQAALIRSLLTQ bHLH transcription factor bHLH135 TMO7 PRE3 Atypical bHLH transcription factor required for MONOPTEROS-dependent root initiation in embryo. Promotes the correct definition of the hypophysis cell division plane. Transcriptionally controlled by MONOPTEROS. Probably unable to bind DNA. BHLH135 moves from its site of synthesis in pro-embryos cells into the hypophysis. Regulates brassinosteroid (BR) signaling by sequestering negative BR signaling components. May function as positive regulator of gibberellin signaling. Transcription factor bHLH135 At1g74500 Basic helix-loop-helix protein 135 Protein ACTIVATION-TAGGED BRI1 SUPPRESSOR 1