Pubertal mammary gland-specific protein 1 Pmg1 Krtap14 Keratin-associated protein 14 In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high- sulfur and high-glycine-tyrosine keratins. Anagen-specific protein KAP13 KRA14_MOUSE 167 MSCNSCSGTFSQSFGGQLQYPISSCGSSYPNNVFYSTDLQTPITHQLGSSLHSGCQETFCEPTNCQTAYVVSRPCQRPFYSQRIRGPCRPCQSTFSGSLGFGSRGFQSFGCGYPSQGFGSHGFQSVGCGTPTFSSLNCGSSFYRPTCFSTKSCQSVSYQPTCGTGFF