HRPAP20 NDUFAF4 175 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4 Involved in the assembly of mitochondrial NADH:ubiquinone oxidoreductase complex (complex I) (By similarity). May be involved in cell proliferation and survival of hormone-dependent tumor cells. May be a regulator of breast tumor cell invasion (By similarity). NDUF4_BOVIN MGAAVARAVRNFNLENRAEREISRMKPSPAPRHPSTKNLLLEQMSSHPEIKGEIDRKDDKLLSLLKDVYVDSQDPVSSLQVKDATARQKPKEFRLPKDHQFDMMDVKNIPKGKISIVEALTLLNNHKLYPDTWTAKKIAEEYHLEQQDVNSLLKYFVTFEVKIFPPEGKKAIESK Hormone-regulated proliferation-associated protein of 20 kDa