Lactose synthase B protein Alpha-lactalbumin B/C KQFTKCQLSQVLKSMDGYKGVTLPEWICTIFHNSGYDTQTIVKNNGKTEYGLFEINNKMWCRDNQILPSRNICGISCNKFLDDDLTDDVMCAKKDLDSEGIDYWLAHKPLCSEKLEQWLCEEL 123 Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins. LALB2_HORSE