MDQETVGNVVLLAIVTLISVIQNGFFAHKVEHESKTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLVMLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERRQSTPGYIFGKRIILFLFLMSLAGIFNYYLILFFGSDFENYIKTITTT Arachidonate 5-lipoxygenase-activating protein (Fragment) ALOX5AP FLAP MK-886-binding protein 153 Required for leukotriene biosynthesis by ALOX5 (5- lipoxygenase). Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes (By similarity). unstructured (By similarity). AL5AP_HORSE FLAP